Structure of PDB 8bq8 Chain A Binding Site BS01

Receptor Information
>8bq8 Chain A (length=89) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLMNIVLHKEDGLGFSIAGGVGNQHIINDNGIFVTKIIEGGAAFQDGRLE
VGDRITKVNTLSLENVTHEEAVAILKETADVVSLVVVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bq8 Crystal structure of Trichoplax Dlg PDZ2 domain in complex with Trichoplax Vangl peptide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		L329 F331 S332 I333 N339 T351 K352 H384 V388
Binding residue
(residue number reindexed from 1)		L13 F15 S16 I17 N23 T35 K36 H68 V72
Enzymatic activity
Enzyme Commision number ?
External links