Structure of PDB 8bp4 Chain A Binding Site BS01

Receptor Information
>8bp4 Chain A (length=93) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGSTIITSLQRKEGHSLGFSITGGFKQADGQYSGIYISKIAKDSIAAVDG
KLSAGDILLKINDESMTNVPHSRAVQMLRSEGKIITIVASRQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bp4 Crystal structure of Trichoplax Scribble PDZ2 domain in complex with Trichoplax Vangl peptide
Resolution1.15 Å
Binding residue
(original residue number in PDB)		S13 L14 G15 F16 S17 I18 T19 F22 S35 K36 H68 V72 R76
Binding residue
(residue number reindexed from 1)		S16 L17 G18 F19 S20 I21 T22 F25 S38 K39 H71 V75 R79
Enzymatic activity
Enzyme Commision number ?
External links