Structure of PDB 8bj0 Chain A Binding Site BS01

Receptor Information
>8bj0 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVEEIRLPRAGGPLGLSIVGGSDHSSHPVQEPGVFISKVLPRGLAARSG
LRVGDRILAVNGQDVRDATHQEAVSALLRPLELSLLVRRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bj0 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.6 Å
Binding residue
(original residue number in PDB)		P1013 L1014 G1015 L1016 S1017 I1018 H1024 H1027 K1040 H1071 Q1072
Binding residue
(residue number reindexed from 1)		P14 L15 G16 L17 S18 I19 H25 H28 K39 H70 Q71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8bj0, PDBe:8bj0, PDBj:8bj0
PDBsum8bj0
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]