Structure of PDB 8b9u Chain A Binding Site BS01

Receptor Information
>8b9u Chain A (length=141) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLES
LGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHN
YIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b9u Clp-targeting BacPROTACs impair mycobacterial proteostasis and survival.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
E3 F5 L88 E89 L92
Binding residue
(residue number reindexed from 1)
E2 F4 L87 E88 L91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b9u, PDBe:8b9u, PDBj:8b9u
PDBsum8b9u
PubMed37137307
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]