Structure of PDB 8b8o Chain A Binding Site BS01

Receptor Information
>8b8o Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVEEIRLPAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARS
GLRVGDRILAVNGQDVRDATHQEAVSALLRPCELSLLVRRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b8o Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.9 Å
Binding residue
(original residue number in PDB)
L1014 L1016 S1017 I1018 S1039 K1040 H1071 V1075 L1079
Binding residue
(residue number reindexed from 1)
L14 L16 S17 I18 S39 K40 H71 V75 L79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b8o, PDBe:8b8o, PDBj:8b8o
PDBsum8b8o
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]