Structure of PDB 8b82 Chain A Binding Site BS01

Receptor Information
>8b82 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGI
FISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQ
MRVWRERM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b82 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R762 E765
Binding residue
(residue number reindexed from 1)
R54 E57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b82, PDBe:8b82, PDBj:8b82
PDBsum8b82
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]