Structure of PDB 8b6l Chain A Binding Site BS01

Receptor Information
>8b6l Chain A (length=425) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPFYWM
RVILELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMII
TIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGY
GLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATR
TDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSYNTY
PIKLFYTSNIPIILQSALVSNLYVISQMLSLLGTWSDRAYPVGGLCYYLS
PPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKE
QQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTG
ILLAVTIIYQYFEIFVKEQSEVGSM
Ligand information
>8b6l Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PVPVLVMSLLFIASVFMLHIW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b6l Visualization of translation and protein biogenesis at the ER membrane.
Resolution7.6 Å
Binding residue
(original residue number in PDB)		W34 I37 V44 C45 L150 I161 L164 L165
Binding residue
(residue number reindexed from 1)		W31 I34 V41 C42 L127 I138 L141 L142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005262 calcium channel activity
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0007029 endoplasmic reticulum organization
GO:0015031 protein transport
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0039019 pronephric nephron development
GO:0045047 protein targeting to ER
GO:0045048 protein insertion into ER membrane
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005784 Sec61 translocon complex
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b6l, PDBe:8b6l, PDBj:8b6l
PDBsum8b6l
PubMed36697828
UniProtP61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 (Gene Name=SEC61A1)

[Back to BioLiP]