Structure of PDB 8b5x Chain A Binding Site BS01

Receptor Information
>8b5x Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTAL
MSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAA
FTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGES
LQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPV
Ligand information
>8b5x Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEDSWTSLEHILWPFTRLRHNGPPPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b5x Crystal structure of SUN1-KASH6 reveals an asymmetric higher order LINC architecture compatible with nuclear membrane insertion
Resolution1.98 Å
Binding residue
(original residue number in PDB)		T665 A666 L667 M668 S669 W676 F678 R683 G693 A697 S735 Y798 C800 Y802
Binding residue
(residue number reindexed from 1)		T48 A49 L50 M51 S52 W59 F61 R66 G76 A80 S118 Y181 C183 Y185
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b5x, PDBe:8b5x, PDBj:8b5x
PDBsum8b5x
PubMed38291267
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]