Structure of PDB 8b5c Chain A Binding Site BS01

Receptor Information
>8b5c Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAV
KLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYN
KPGDDIVLMAEALEKLFLQKINELPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b5c Synthesis, Biochemical Characterization, and Genetic Encoding of a 1,2,4-Triazole Amino Acid as an Acetyllysine Mimic for Bromodomains of the BET Family.
Resolution1.58 Å
Binding residue
(original residue number in PDB)		F79 W81 F83 L92 L94 D96 I100 I138 Y139 N140 D145 M149
Binding residue
(residue number reindexed from 1)		F39 W41 F43 L52 L54 D56 I60 I98 Y99 N100 D105 M109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b5c, PDBe:8b5c, PDBj:8b5c
PDBsum8b5c
PubMed36585954
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]