Structure of PDB 8b58 Chain A Binding Site BS01

Receptor Information
>8b58 Chain A (length=199) Species: 5811 (Toxoplasma gondii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLLSESELPAGISYAEAMEGGSRPLLHPDNPVVFFDISIGSHEAGRIKIE
LFKNLAPKSAENFRQFCTGEFRQNQVPIGYKGATFHRIIKNFMIQGGDFV
KGDGTGRLSIYGSSFPDEAFVLPHFRSGLLSLANSGPDTNGCQFFITCAK
CDWLNRKHVVFGQVLGKESMQVVRKIEHVTVDGGNRPRIPVTVTQCGEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b58 Structural Basis for Cyclosporin Isoform-Specific Inhibition of Cyclophilins from Toxoplasma gondii .
Resolution1.1 Å
Binding residue
(original residue number in PDB)		R99 F104 Q107 G116 A145 N146 S147 Q155 F157 W165 H170
Binding residue
(residue number reindexed from 1)		R87 F92 Q95 G104 A133 N134 S135 Q143 F145 W153 H158
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding
Cellular Component
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b58, PDBe:8b58, PDBj:8b58
PDBsum8b58
PubMed36653744
UniProtB9PS61

[Back to BioLiP]