Structure of PDB 8b4e Chain A Binding Site BS01

Receptor Information
>8b4e Chain A (length=107) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVISR
NDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGYQ
LIARVET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b4e ToxR activates the Vibrio cholerae virulence genes by tethering DNA to the membrane through versatile binding to multiple sites.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		T77 Q78 S81 K85 T91 T99 P101 K102 Y105
Binding residue
(residue number reindexed from 1)		T71 Q72 S75 K79 T85 T93 P95 K96 Y99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8b4e, PDBe:8b4e, PDBj:8b4e
PDBsum8b4e
PubMed37428913
UniProtP15795|TOXR_VIBCH Cholera toxin transcriptional activator (Gene Name=toxR)

[Back to BioLiP]