Structure of PDB 8b2f Chain A Binding Site BS01

Receptor Information
>8b2f Chain A (length=74) Species: 223377 (Trichophaea saccata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPVKTDLHCRSSPSTSASIVRTYSSGTEVQIQCQTTGTSVQGSNVWDKTQ
HGCYVADYYVKTGHSGIFTTKCGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b2f Module walking using an SH3-like cell-wall-binding domain leads to a new GH184 family of muramidases.
Resolution1.183 Å
Binding residue
(original residue number in PDB)		D6 L7 H8 R10
Binding residue
(residue number reindexed from 1)		D6 L7 H8 R10
External links