Structure of PDB 8b18 Chain A Binding Site BS01

Receptor Information

>8b18 Chain A (length=451) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QQPRPFFMIFFVELWERFGYYGVQGVLAVFFVKQLGFSQEQAFVTFGAFA
ALVYGLISIGGYVGDHLLGTKRTIVLGALVLAIGYFMTGMSLLKPDLIFI
ALGTIAVGNGLFKANPASLLSKCYPPKDPRLDGAFTLFYMSINIGSLIAL
SLAPVIADRFGYSVTYNLCGAGLIIALLVYIACRGMVKDIGSEPDFRPMS
FSKLLYVLLGSVVMIFVCAWLMHNVEVANLVLIVLSIVVTIIFFRQNKMF
VAFVLMLEAVVFYILYAQMPTSLNFFAINNVHHEILGFSINPVSFQALNP
FWVVLASPILAGILSMPMKFTLGMFMCSLGFLTAAAAGMWFADAQGLTSP
WFIVLVYLFQSLGELFISALGLAMIAALVMGFILGMWFLTQAAAFLLGGY
VATFTAVPDNITDPLETLPVYTNVFGKIGLVTLGVAVVMLLMVPWLKRMI
A

Ligand information

>8b18 Chain C (length=2) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8b18 Plasticity of the binding pocket in peptide transporters underpins promiscuous substrate recognition.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R27 Y31 Y64 K123 Y149 I152 N153 S156 Y282 Y285 N318 E393
Binding residue (residue number reindexed from 1)	R17 Y21 Y54 K113 Y139 I142 N143 S146 Y263 Y266 N299 E364

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0015078	proton transmembrane transporter activity
GO:0015333	peptide:proton symporter activity
GO:0022857	transmembrane transporter activity
GO:0042937	tripeptide transmembrane transporter activity
GO:0071916	dipeptide transmembrane transporter activity
GO:1904680	peptide transmembrane transporter activity

	Biological Process
GO:0006857	oligopeptide transport
GO:0015031	protein transport
GO:0015833	peptide transport
GO:0035442	dipeptide transmembrane transport
GO:0035443	tripeptide transmembrane transport
GO:0042938	dipeptide transport
GO:0042939	tripeptide transport
GO:0055085	transmembrane transport
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b18, PDBe:8b18, PDBj:8b18
PDBsum	8b18
PubMed	37467108
UniProt	P36837\|DTPB_ECOLI Dipeptide and tripeptide permease B (Gene Name=dtpB)

[Back to BioLiP]