Structure of PDB 8anv Chain A Binding Site BS01

Receptor Information
>8anv Chain A (length=66) Species: 10736 (Bacillus phage phi3T) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNNKYYTEENKKKVWKKHMIVLKFLEQPGISEAYLNYLQEEIHNDEWIGF
ENEFFEELTGKPVINV
Ligand information
>8anv Chain C (length=14) Species: 10736 (Bacillus phage phi3T) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISYEEMAKGYEEMA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8anv Antagonistic interactions between phage and host factors control arbitrium lysis-lysogeny decision
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N4 K5 Y6 Y7
Binding residue
(residue number reindexed from 1)		N3 K4 Y5 Y6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:8anv, PDBe:8anv, PDBj:8anv
PDBsum8anv
PubMed38177302
UniProtA0A1P8CWW1

[Back to BioLiP]