Structure of PDB 8ad9 Chain A Binding Site BS01

Receptor Information
>8ad9 Chain A (length=148) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGFRRFTPRARNAVVAAQNAAHGAASSEITPDHLLLGVLTDPAALATALL
QQQEIDIATLRTAVTLPPAVTEPPQPIPFSGPARKVLELTFREALRLGHN
YIGTEHLLLALLELEDGDGPLHRSGVDKSRAEADLITTLASLTGANAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ad9 ClpC2 protects mycobacteria against a natural antibiotic targeting ClpC1-dependent protein degradation.
Resolution1.43 Å
Binding residue
(original residue number in PDB)
P101 R104 V108
Binding residue
(residue number reindexed from 1)
P8 R11 V15
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ad9, PDBe:8ad9, PDBj:8ad9
PDBsum8ad9
PubMed36944713
UniProtP9WPC7|Y2667_MYCTU Uncharacterized protein Rv2667 (Gene Name=Rv2667)

[Back to BioLiP]