Structure of PDB 8a3t Chain A Binding Site BS01

Receptor Information
>8a3t Chain A (length=219) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQQ
NPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDN
YDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAG
HSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHEN
GKDTHLRGIRLYVPSAILR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a3t Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y148 N208
Binding residue
(residue number reindexed from 1)		Y140 N200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030234 enzyme regulator activity
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0006325 chromatin organization
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070979 protein K11-linked ubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a3t, PDBe:8a3t, PDBj:8a3t
PDBsum8a3t
PubMed
UniProtP53068|APC10_YEAST Anaphase-promoting complex subunit DOC1 (Gene Name=DOC1)

[Back to BioLiP]