Structure of PDB 8a1c Chain A Binding Site BS01

Receptor Information
>8a1c Chain A (length=301) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLDITTITRQNVTSVVGYYSDAKDDYYSKDSFTSWQGTGAEALGLSGDVE
SARFKELLVGEIDTFTHMQRHVDAKKERLGYDLTFSAPKGVSMQALIHGD
KTIIEAHEKAVAAAVREAEKLAQARTTRQGKSVTQNTNNLVVATFRHETS
RALDPDLHTHAFVMNMTQREDGQWRALKNDELMRNKMHLGDVYKQELALE
LTKAGYELRYNSKNNTFDMAHFSDEQIRAFSRRSEQIEKGLAAMGLTRET
ADAQTKSRVSMATREKEHSREEIHQEWASRAKTLGIDFDNREWQGALEVL
F
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a1c Structural and functional characterization of TraI from pKM101 reveals basis for DNA processing.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		M1 L2 D3 T5 K78 R80 T86 K91 R153 H160 H162 N181 D182 M185 K188 M189 K196 N216 S233 R235 S236 I239 R250 A255 Q256 S262
Binding residue
(residue number reindexed from 1)		M1 L2 D3 T5 K76 R78 T84 K89 R151 H158 H160 N179 D180 M183 K186 M187 K194 N214 S231 R233 S234 I237 R248 A253 Q254 S260
Enzymatic activity
Enzyme Commision number ?
External links