Structure of PDB 7zxy Chain A Binding Site BS01

Receptor Information

>7zxy Chain A (length=220) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFL
IQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVL
MMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGY
WAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPWAI
AVLLLLHFLMIRKQGISGPL

Ligand information

>7zxy Chain H (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MDILTLGWVSVLVLFTWSISMVVWGRNGF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution	3.15 Å
Binding residue (original residue number in PDB)	V37 I39 F40
Binding residue (residue number reindexed from 1)	V35 I37 F38

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0045158	electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis
GO:0022904	respiratory electron transport chain

	Cellular Component
GO:0009512	cytochrome b6f complex
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum	7zxy
PubMed	35726684
UniProt	Q57038\|CYB6_SYNY3 Cytochrome b6 (Gene Name=petB)

[Back to BioLiP]