Structure of PDB 7zvx Chain A Binding Site BS01

Receptor Information

>7zvx Chain A (length=307) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKE
LASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEII
CSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAED
GSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRY
KSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG
TRDKVLIRIMASRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALL
YLCGGDD

Ligand information

>7zvx Chain C (length=6) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuuc

......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7zvx Structures of annexin A2-PS DNA complexes show dominance of hydrophobic interactions in phosphorothioate binding.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	K115 K119
Binding residue (residue number reindexed from 1)	K83 K87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0002020	protease binding
GO:0003723	RNA binding
GO:0004859	phospholipase inhibitor activity
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005544	calcium-dependent phospholipid binding
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	cytoskeletal protein binding
GO:0019834	phospholipase A2 inhibitor activity
GO:0042802	identical protein binding
GO:0044548	S100 protein binding
GO:0048306	calcium-dependent protein binding
GO:0098641	cadherin binding involved in cell-cell adhesion

	Biological Process
GO:0001525	angiogenesis
GO:0001765	membrane raft assembly
GO:0001921	positive regulation of receptor recycling
GO:0002091	negative regulation of receptor internalization
GO:0006900	vesicle budding from membrane
GO:0007155	cell adhesion
GO:0007160	cell-matrix adhesion
GO:0010756	positive regulation of plasminogen activation
GO:0014823	response to activity
GO:0030199	collagen fibril organization
GO:0030324	lung development
GO:0031340	positive regulation of vesicle fusion
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035	osteoclast development
GO:0042730	fibrinolysis
GO:0042789	mRNA transcription by RNA polymerase II
GO:0044090	positive regulation of vacuole organization
GO:0045921	positive regulation of exocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050767	regulation of neurogenesis
GO:0098609	cell-cell adhesion
GO:1904019	epithelial cell apoptotic process
GO:1905581	positive regulation of low-density lipoprotein particle clearance
GO:1905597	positive regulation of low-density lipoprotein particle receptor binding
GO:1905599	positive regulation of low-density lipoprotein receptor activity
GO:1905602	positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686	positive regulation of plasma membrane repair

	Cellular Component
GO:0001533	cornified envelope
GO:0005576	extracellular region
GO:0005604	basement membrane
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005769	early endosome
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0009986	cell surface
GO:0012506	vesicle membrane
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016363	nuclear matrix
GO:0030496	midbody
GO:0031902	late endosome membrane
GO:0031982	vesicle
GO:0035578	azurophil granule lumen
GO:0035749	myelin sheath adaxonal region
GO:0042383	sarcolemma
GO:0042470	melanosome
GO:0043220	Schmidt-Lanterman incisure
GO:0045121	membrane raft
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0090575	RNA polymerase II transcription regulator complex
GO:0098797	plasma membrane protein complex
GO:1990665	AnxA2-p11 complex
GO:1990667	PCSK9-AnxA2 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zvx, PDBe:7zvx, PDBj:7zvx
PDBsum	7zvx
PubMed	36124719
UniProt	P07355\|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2)

[Back to BioLiP]