Structure of PDB 7zrr Chain A Binding Site BS01

Receptor Information
>7zrr Chain A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIAL
LKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLY
PEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG
PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zrr Crystal structure of human Urokinase-type plasminogen activator in complex with bicycle peptide inhibitor UK965
Resolution1.64 Å
Binding residue
(original residue number in PDB)		R20 H22 R23 Y29 V30 C31 H46 D50 H94 Y150 D192 S193 C194 Q195 G196 S198 G221 G229
Binding residue
(residue number reindexed from 1)		R20 H22 R23 Y29 V30 C31 H46 D50 H94 Y150 D192 S193 C194 Q195 G196 S198 G221 G229
Enzymatic activity
Enzyme Commision number 3.4.21.73: u-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7zrr, PDBe:7zrr, PDBj:7zrr
PDBsum7zrr
PubMed
UniProtP00749|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]