Structure of PDB 7zqj Chain A Binding Site BS01

Receptor Information
>7zqj Chain A (length=274) Species: 39621 (Acrocephalus arundinaceus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLHSLHYLDVAVSEPSPGIPQFVAMGFVDGIPFTRYDSERGRMEPLTEW
IKDSADPEYWDSQTQIGVGSQHVYARSLETLRERYNQSGGLHTVLRVYGC
ELLSDGSVRGSERFGYDGRDFISFDLESGRFMAADSAAEITRRRWEHEGI
VAERQTNYLKHECPEWLQKYVGYGQKELERKEPPDVHVSGKEEHGTLILS
CHAYGFYPKTIAVNWMKGDEIWDQETEWGGVVPNSDGTFHTWARIEALPE
EREQYRCRVEHPGMPEPGIFAWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zqj Extraordinary peptide-binding mode of a songbird MHC class-I molecule suggests mechanism to counter pathogen immune evasion
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y9 M45 Q64 I67 S71 V74 Y75 S78 L82 R97 Y99 F115 F122 R145 W146 V152 R155 Q156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y8 M44 Q63 I66 S70 V73 Y74 S77 L81 R96 Y98 F114 F121 R144 W145 V151 R154 Q155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links