Structure of PDB 7zqi Chain A Binding Site BS01

Receptor Information
>7zqi Chain A (length=274) Species: 39621 (Acrocephalus arundinaceus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLHSLHYLDVAVSEPSPGIPQFVAMGFVDGIPFTRYDSERGRMEPLTEW
IKDSADPEYWDSQTQIGVGSQHVYARSLETLRERYNQSGGLHTVLRVYGC
ELLSDGSVRGSERFGYDGRDFISFDLESGRFMAADSAAEITRRRWEHEGI
VAERQTNYLKHECPEWLQKYVGYGQKELERKEPPDVHVSGKEEHGTLILS
CHAYGFYPKTIAVNWMKGDEIWDQETEWGGVVPNSDGTFHTWARIEALPE
EREQYRCRVEHPGMPEPGIFAWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zqi Extraordinary peptide-binding mode of a songbird MHC class-I molecule suggests mechanism to counter pathogen immune evasion
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Y9 M45 S63 Q64 I67 G68 G70 S71 V74 Y75 S78 L82 R85 V95 R97 F115 F122 T142 R145 W146 R155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y8 M44 S62 Q63 I66 G67 G69 S70 V73 Y74 S77 L81 R84 V94 R96 F114 F121 T141 R144 W145 R154 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links