Structure of PDB 7zpi Chain A Binding Site BS01

Receptor Information
>7zpi Chain A (length=705) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPGSTKRRQCYPKAIPECLRESYPKPDQPCYLYVIGMVLTTPLPDELNFR
RRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTL
SQQMLELITRLHQYIFSHILRLEKPALEFKPTGAESAYCVLPLNVVNDSG
TLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRN
FDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLL
DVDHTSSRLNLLTPRHLVPELCAIHPIPASLWRKAVCLPSILYRLHCLLT
AEELRAQTASDAGVGVRSLPLGPNPGLILQALTLSNASDGFNLERLEMLG
DSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRM
VVSIFDPPVNWLPPGYVVNQDLHTEQCIADKSIADCVEALLGCYLTSCGE
RAAQLFLCSLGLKVLAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTH
ASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSAL
VNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKIEVPKAMGDI
FESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEME
PETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRS
LKANQ
Ligand information
>7zpi Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagcagcacauaaugguuuguggauguugggugcaggccauacugugcug
ccuca
..<<<<<<<<..<<<<<<<<<<.........>>>>>>>>>>..>>>>>>>
>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zpi Structural and functional basis of mammalian microRNA biogenesis by Dicer.
Resolution5.91 Å
Binding residue
(original residue number in PDB)		R739 S742 T743 K744 R746 R859 R937 H943 R944 F960 Y971 K975 Y976 H992 T993 R1003 N1305 K1553 R1892
Binding residue
(residue number reindexed from 1)		R1 S4 T5 K6 R8 R121 R199 H205 R206 F222 Y233 K237 Y238 H254 T255 R265 N336 K431 R687
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0004386 helicase activity
GO:0004519 endonuclease activity
GO:0004525 ribonuclease III activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0035198 miRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001525 angiogenesis
GO:0001834 trophectodermal cell proliferation
GO:0001932 regulation of protein phosphorylation
GO:0001942 hair follicle development
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0007284 spermatogonial cell division
GO:0008283 cell population proliferation
GO:0008593 regulation of Notch signaling pathway
GO:0009791 post-embryonic development
GO:0010070 zygote asymmetric cell division
GO:0010467 gene expression
GO:0010468 regulation of gene expression
GO:0010626 negative regulation of Schwann cell proliferation
GO:0010628 positive regulation of gene expression
GO:0010660 regulation of muscle cell apoptotic process
GO:0014040 positive regulation of Schwann cell differentiation
GO:0014835 myoblast differentiation involved in skeletal muscle regeneration
GO:0019827 stem cell population maintenance
GO:0021522 spinal cord motor neuron differentiation
GO:0021675 nerve development
GO:0021889 olfactory bulb interneuron differentiation
GO:0021987 cerebral cortex development
GO:0030324 lung development
GO:0030326 embryonic limb morphogenesis
GO:0030422 siRNA processing
GO:0030856 regulation of epithelial cell differentiation
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0031069 hair follicle morphogenesis
GO:0031508 pericentric heterochromatin formation
GO:0031641 regulation of myelination
GO:0031643 positive regulation of myelination
GO:0032290 peripheral nervous system myelin formation
GO:0035116 embryonic hindlimb morphogenesis
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196 miRNA processing
GO:0035264 multicellular organism growth
GO:0042487 regulation of odontogenesis of dentin-containing tooth
GO:0045069 regulation of viral genome replication
GO:0045589 regulation of regulatory T cell differentiation
GO:0045664 regulation of neuron differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048255 mRNA stabilization
GO:0048536 spleen development
GO:0048565 digestive tract development
GO:0048608 reproductive structure development
GO:0048713 regulation of oligodendrocyte differentiation
GO:0048730 epidermis morphogenesis
GO:0048754 branching morphogenesis of an epithelial tube
GO:0048812 neuron projection morphogenesis
GO:0050727 regulation of inflammatory response
GO:0050767 regulation of neurogenesis
GO:0051216 cartilage development
GO:0051225 spindle assembly
GO:0051252 regulation of RNA metabolic process
GO:0051607 defense response to virus
GO:0051726 regulation of cell cycle
GO:0055013 cardiac muscle cell development
GO:0060119 inner ear receptor cell development
GO:0060253 negative regulation of glial cell proliferation
GO:0060576 intestinal epithelial cell development
GO:0061309 cardiac neural crest cell development involved in outflow tract morphogenesis
GO:0061548 ganglion development
GO:0070173 regulation of enamel mineralization
GO:0070922 RISC complex assembly
GO:0071335 hair follicle cell proliferation
GO:0098795 global gene silencing by mRNA cleavage
GO:2000628 regulation of miRNA metabolic process
GO:2000630 positive regulation of miRNA metabolic process
GO:2000736 regulation of stem cell differentiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016442 RISC complex
GO:0048471 perinuclear region of cytoplasm
GO:0070578 RISC-loading complex
GO:0098978 glutamatergic synapse
GO:0099092 postsynaptic density, intracellular component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zpi, PDBe:7zpi, PDBj:7zpi
PDBsum7zpi
PubMed36332606
UniProtQ8R418|DICER_MOUSE Endoribonuclease Dicer (Gene Name=Dicer1)

[Back to BioLiP]