Structure of PDB 7zgv Chain A Binding Site BS01

Receptor Information
>7zgv Chain A (length=246) Species: 613 (Serratia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKKLSRINGREFLKQSFNLQQQLLASQLNLSRTITHDGTMGEVNESYFLS
IIRQYLPERYSVDRGVVVDSEGQTSDQIDAVIFDRHYTPTLLDQQGHRFI
PAEAVYAVLEVKPTINKTYLEYAADKAASVRKLYRTSTVIKNIYGTAKPV
EHFPIVAGIVAIDVEWQDGLGKAFTENLQAVSSDENRKLDCGLAVSGACF
DSYDEEIKIRSGENALIFFLFRLLGKLQSLGTVPAIDWRVYIDSLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zgv Type III CRISPR-Cas provides resistance against nucleus-forming jumbo phages via abortive infection.
Resolution1.48 Å
Binding residue
(original residue number in PDB)
Y91 I144 N146 I147 T236 V237 P238 A239
Binding residue
(residue number reindexed from 1)
Y87 I140 N142 I143 T232 V233 P234 A235
Enzymatic activity
Enzyme Commision number ?
External links