Structure of PDB 7zfr Chain A Binding Site BS01

Receptor Information

>7zfr Chain A (length=181) Species: 9606 (Homo sapiens)

IKADHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGR
AFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELG
QPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHY
LTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ

Ligand information

>7zfr Chain C (length=12) Species: 9606 (Homo sapiens)

IEFVFKNKAKEL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7zfr Machine learning predictions of MHC-II specificities reveal alternative binding mode of class II epitopes.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): Y9 Q31 F52 S53 N62 I65 L66 N68 N69 L73 R76
• Binding residue (residue number reindexed from 1): Y9 Q31 F52 S53 N62 I65 L66 N68 N69 L73 R76

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 08:09:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7zfr', asym_id = 'A', bs = 'BS01', title = 'Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7zfr', asym_id='A', bs='BS01', title='Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7zfr', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7zfr', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>