Structure of PDB 7zex Chain A Binding Site BS01

Receptor Information
>7zex Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHR
GFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zex RNA binding induces an allosteric switch in Cyp33 to repress MLL1-mediated transcription.
ResolutionN/A
Binding residue
(original residue number in PDB)		V7 Y9 D34 Q36 L39 D40 Y41 E44 R47 F49 F51 E53 R78 N80 A82 K83 P84 M85 I87 K88
Binding residue
(residue number reindexed from 1)		V10 Y12 D37 Q39 L42 D43 Y44 E47 R50 F52 F54 E56 R81 N83 A85 K86 P87 M88 I90 K91
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7zex, PDBe:7zex, PDBj:7zex
PDBsum7zex
PubMed37075125
UniProtQ9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E (Gene Name=PPIE)

[Back to BioLiP]