Structure of PDB 7zax Chain A Binding Site BS01

Receptor Information
>7zax Chain A (length=133) Species: 573 (Klebsiella pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKTGDTDQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTR
PGNEKGKEVIEGFGNPATFYQMQDNGKPVKGRASKMRYELQNDYVVLTGN
AYLEQLDSNIKGDKITYLVKEQKMQAFSDKGRR
Ligand information
>7zax Chain B (length=16) Species: 29025 (Podisus maculiventris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VPITYCNRPTKKCPRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zax Peptidomimetic antibiotics disrupt the lipopolysaccharide transport bridge of drug-resistant Enterobacteriaceae.
ResolutionN/A
Binding residue
(original residue number in PDB)		D31 T32 P35 I36 H37 I38 E39 D41 Q42 Q43 L45 N50 R76 K81 L116
Binding residue
(residue number reindexed from 1)		D5 T6 P9 I10 H11 I12 E13 D15 Q16 Q17 L19 N24 R50 K55 L90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001530 lipopolysaccharide binding
Biological Process
GO:0015920 lipopolysaccharide transport
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zax, PDBe:7zax, PDBj:7zax
PDBsum7zax
PubMed37224246
UniProtA6TEL9

[Back to BioLiP]