Structure of PDB 7zap Chain A Binding Site BS01

Receptor Information
>7zap Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNS
RRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAA
Ligand information
>7zap Chain B (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggauuuccccaaaugugggaaacuccc
<<<<<<<<<<.......>>>>>>.>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zap Molecular basis of RNA-binding and autoregulation by the cancer-associated splicing factor RBM39.
ResolutionN/A
Binding residue
(original residue number in PDB)		F156 M158 Q159 A161 R163 I164 R165 R183 I185 S186 D187 R188 N189 S190 R191 R192 S193 K194 I196 Y198 L219 V221
Binding residue
(residue number reindexed from 1)		F16 M18 Q19 A21 R23 I24 R25 R43 I45 S46 D47 R48 N49 S50 R51 R52 S53 K54 I56 Y58 L79 V81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zap, PDBe:7zap, PDBj:7zap
PDBsum7zap
PubMed37666821
UniProtG3XAC6

[Back to BioLiP]