Structure of PDB 7z7c Chain A Binding Site BS01

Receptor Information
>7z7c Chain A (length=158) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAAVDGQDDEVRILMANGADVNAADWWGLTPLHLAAWHGHLEI
VEVLLKTGADVNASDNNGITPLHLAAARGHLEIVEVLLKAGADVNARDTS
GDTPLHLAAMQGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIA
EVLQKAAK
Ligand information
>7z7c Chain B (length=22) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSVHLGPGQAFYATDGIIGEIR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z7c Trapping the HIV-1 V3 loop in a helical conformation enables broad neutralization.
Resolution1.22 Å
Binding residue
(original residue number in PDB)		W36 L38 L43 W46 H47 D67 N69 I71 A79 R80 S102 D104 L109 M112 Q113 D133 F135 L142
Binding residue
(residue number reindexed from 1)		W34 L36 L41 W44 H45 D65 N67 I69 A77 R78 S100 D102 L107 M110 Q111 D131 F133 L140
External links