Structure of PDB 7z5i Chain A Binding Site BS01

Receptor Information
>7z5i Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRY
IESLQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z5i Transcription factor MYF5 bound to symmetrical site
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R84 R91 E92 R94 R95
Binding residue
(residue number reindexed from 1)
R4 R11 E12 R14 R15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007517 muscle organ development

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7z5i, PDBe:7z5i, PDBj:7z5i
PDBsum7z5i
PubMed
UniProtP13349|MYF5_HUMAN Myogenic factor 5 (Gene Name=MYF5)

[Back to BioLiP]