Structure of PDB 7z50 Chain A Binding Site BS01

Receptor Information

>7z50 Chain A (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEF
GQLILFEPQGGLQNIAAEKHNLGCLTKRSNFTPATNEAPQATVFPKSPVL
LGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKL
SYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP

Ligand information

>7z50 Chain T (length=13) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LQTLALEVEDDPC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z50 Structural plasticity in I-A g7 links autoreactivity to hybrid insulin peptides in type I diabetes.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	Y10 I54 L55 F56 Q63 N64 A67 H70 N71 C74 R78
Binding residue (residue number reindexed from 1)	Y10 I54 L55 F56 Q63 N64 A67 H70 N71 C74 R78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z50, PDBe:7z50, PDBj:7z50
PDBsum	7z50
PubMed	35967292
UniProt	P04228\|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]