Structure of PDB 7z4a Chain A Binding Site BS01

Receptor Information
>7z4a Chain A (length=227) Species: 1519788 (Escherichia phage vB_EcoP_SU10) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPDVQYPINTYGWLKKAVALWADRDDDEFVNQIPNFINFAEKEIYRNLRI
PPLEKEVYLDIKDGVAYIPPDYLEAQWMMRAKDGTIFQVTSPEEISYRRQ
HGNQPVNFARFGSRFIFYPSIEADTPYYPDDGSPLIPAENSVILSYYADP
PEFHEDTDTSTILTIAPELLLYFTLRHACLFVQDDNGVQKWSALGKAILD
EMVEQNKKQEYSGSPIAIPNNMTRLQS
Ligand information
>7z4a Chain O (length=29) Species: 1519788 (Escherichia phage vB_EcoP_SU10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IVYNNQAPDAVNNVGQFGATEGSIGAYKQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z4a Tail proteins of phage SU10 reorganize into the nozzle for genome delivery.
Resolution4.6 Å
Binding residue
(original residue number in PDB)		N11 P53 P54 T171 T174 I175 N216
Binding residue
(residue number reindexed from 1)		N9 P51 P52 T161 T164 I165 N206
Enzymatic activity
Enzyme Commision number ?
External links