Structure of PDB 7z3x Chain A Binding Site BS01

Receptor Information

>7z3x Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LQSMAAQRQRALAIMCRVFVGSIYYELGEDTIRQAFAPFGPIKSIDMSWD
SVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQP
IIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTT
GKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMP

Ligand information

>7z3x Chain D (length=3) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z3x Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
Resolution	1.65 Å
Binding residue (original residue number in PDB)	F115 G117 S118 G154 F155 F157 R187 P188 S189
Binding residue (residue number reindexed from 1)	F19 G21 S22 G58 F59 F61 R91 P92 S93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7z3x, PDBe:7z3x, PDBj:7z3x
PDBsum	7z3x
PubMed
UniProt	Q9UHX1\|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 (Gene Name=PUF60)

[Back to BioLiP]