Structure of PDB 7z26 Chain A Binding Site BS01

Receptor Information
>7z26 Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GENLYFQHMKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRS
MNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVR
WIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z26 Fragment Ligands of the m 6 A-RNA Reader YTHDF2.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K416 S417 Y418 D422 W432 C433 N462 G463 W486 W491 T524 N525 S526 R527 D528
Binding residue
(residue number reindexed from 1)		K18 S19 Y20 D24 W34 C35 N64 G65 W88 W93 T126 N127 S128 R129 D130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7z26, PDBe:7z26, PDBj:7z26
PDBsum7z26
PubMed36110386
UniProtQ9Y5A9|YTHD2_HUMAN YTH domain-containing family protein 2 (Gene Name=YTHDF2)

[Back to BioLiP]