Structure of PDB 7z0u Chain A Binding Site BS01

Receptor Information
>7z0u Chain A (length=78) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSC
PVKKKVQRSAEDPSLLVATYEGTHNHLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z0u New aspects of DNA recognition by group II WRKY transcription factor revealed by structural and functional study of AtWRKY18 DNA binding domain.
Resolution2.85 Å
Binding residue
(original residue number in PDB)
R182 K183 G185
Binding residue
(residue number reindexed from 1)
R25 K26 G28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7z0u, PDBe:7z0u, PDBj:7z0u
PDBsum7z0u
PubMed35660042
UniProtQ9C5T4|WRK18_ARATH WRKY transcription factor 18 (Gene Name=WRKY18)

[Back to BioLiP]