Structure of PDB 7yzb Chain A Binding Site BS01

Receptor Information
>7yzb Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYE
GWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNT
ALCRRWQFAKDLGPYVLHGRPYRPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yzb Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
Resolution1.47 Å
Binding residue
(original residue number in PDB)		Y28 R30 L56 R82 H83 S86 K93 A103 K104 G105 N106 W108 N124
Binding residue
(residue number reindexed from 1)		Y3 R5 L31 R57 H58 S61 K68 A78 K79 G80 N81 W83 N99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yzb, PDBe:7yzb, PDBj:7yzb
PDBsum7yzb
PubMed36435807
UniProtO75593|FOXH1_HUMAN Forkhead box protein H1 (Gene Name=FOXH1)

[Back to BioLiP]