Structure of PDB 7yxw Chain A Binding Site BS01

Receptor Information
>7yxw Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKGKRGWI
PASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEV
IHKLLDGWWVIRKDDVTGYFPSMYLQKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yxw Targeting NOX2 via p47/phox-p22/phox Inhibition with Novel Triproline Mimetics
Resolution2.5 Å
Binding residue
(original residue number in PDB)
W193 W204 S208 E241 D243 E244 D261 W263 Y274 M278 Y279
Binding residue
(residue number reindexed from 1)
W38 W49 S53 E86 D88 E89 D106 W108 Y119 M123 Y124
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7yxw, PDBe:7yxw, PDBj:7yxw
PDBsum7yxw
PubMed
UniProtP14598|NCF1_HUMAN Neutrophil cytosol factor 1 (Gene Name=NCF1)

[Back to BioLiP]