Structure of PDB 7yxp Chain A Binding Site BS01

Receptor Information
>7yxp Chain A (length=241) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPTLISLLEVIEPEVLYSGYDSTDTSTRLMSTLNRLGGRQVVSAVKWAKA
LPGFRNLHLDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVIN
EERMQLPYMYDQCQQMLKISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGL
KSQAVFDEIRMTYIKELGKAIVKSSQNWQRFYQLTKLLDSMHEMVGGLLQ
FCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yxp The multivalency of the glucocorticoid receptor ligand-binding domain explains its manifold physiological activities.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		V575 K579 R585 L589 M593 Q597 M752 E755 I756 N759
Binding residue
(residue number reindexed from 1)		V45 K49 R55 L59 M63 Q67 M218 E221 I222 N225
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0034056 estrogen response element binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0030518 nuclear receptor-mediated steroid hormone signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yxp, PDBe:7yxp, PDBj:7yxp
PDBsum7yxp
PubMed36464162
UniProtA0A1X8XLE9

[Back to BioLiP]