Structure of PDB 7yue Chain A Binding Site BS01

Receptor Information
>7yue Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA
ISRQGSKTAYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTT
TAFDYWGQGTLVTVSSSTDIQMTQSPSSLSASVGDRVTITCRASQSISSY
LNWYQQKPGKAPKLLIYQASALQSGVPSRFSGSGSGTDFTLTISSLQPED
FATYYCQQSHRRPLTFGQGTKVEIK
Ligand information
>7yue Chain C (length=8) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFIEDLLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yue Epitope-directed anti-SARS-CoV-2 scFv engineered against the key spike protein region could block membrane fusion.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		I53 K59 T60 T101 T102 T103 Y166 S225 H226 R228
Binding residue
(residue number reindexed from 1)		I51 K57 T58 T99 T100 T101 Y150 S209 H210 R212
External links