Structure of PDB 7yom Chain A Binding Site BS01

Receptor Information
>7yom Chain A (length=302) Species: 71421 (Haemophilus influenzae Rd KW20) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMV
WQAEKDGTLTKGKEIVEPTSGNTGIALAYVAAARGYKITLTMPETMSIER
KRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANP
QIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSV
AVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVD
SDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPS
SS
Ligand information
>7yom Chain B (length=8) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IGDGYEFT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yom Crystal structure of I88L single mutant of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide from serine acetyltransferase of Salmonella typhimurium at 2.14 A
Resolution2.8 Å
Binding residue
(original residue number in PDB)		X42 S70 G71 M120 F144 G177 H224 K225 Q227 G228 A231
Binding residue
(residue number reindexed from 1)		X42 S70 G71 M120 F144 G177 H224 K225 Q227 G228 A231
Enzymatic activity
Enzyme Commision number 2.5.1.47: cysteine synthase.
Gene Ontology
Molecular Function
GO:0004124 cysteine synthase activity
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0080146 L-cysteine desulfhydrase activity
Biological Process
GO:0006535 cysteine biosynthetic process from serine
GO:0019344 cysteine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yom, PDBe:7yom, PDBj:7yom
PDBsum7yom
PubMed
UniProtP45040|CYSK_HAEIN Cysteine synthase (Gene Name=cysK)

[Back to BioLiP]