Structure of PDB 7ykg Chain A Binding Site BS01

Receptor Information
>7ykg Chain A (length=188) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGS
KLVSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDL
RHYLNLRFQKGSVDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFI
TVEEFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ykg The cryptic GK domain of MAGI binds to a diverse set of targets in a phosphorylation-dependent manner
Resolution2.16 Å
Binding residue
(original residue number in PDB)
Y134 T137 P139 R143 Y155 E174 G176 T177 Y178 Y183 G184 T185
Binding residue
(residue number reindexed from 1)
Y126 T129 P131 R135 Y147 E166 G168 T169 Y170 Y175 G176 T177
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ykg, PDBe:7ykg, PDBj:7ykg
PDBsum7ykg
PubMed37163606
UniProtQ9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)

[Back to BioLiP]