Structure of PDB 7ykd Chain A Binding Site BS01

Receptor Information
>7ykd Chain A (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAV
ADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTII
SSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANL
HGKISCFNNFSLSDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCK
LQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSL
GLPLATALAIANSCMNPILYVFMGQDFKKFKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ykd Cryo-EM structure of the human chemerin receptor 1-Gi protein complex bound to the C-terminal nonapeptide of chemerin.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		H95 Y103 N116 L119 I120 M123 R178 L183 C189 F190 N191 R224 E283 H286 F294 S295 L298
Binding residue
(residue number reindexed from 1)		H62 Y70 N83 L86 I87 M90 R145 L150 C156 F157 N158 R178 E237 H240 F248 S249 L252
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004950 chemokine receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0097003 adipokinetic hormone receptor activity
GO:0097004 adipokinetic hormone binding
Biological Process
GO:0001501 skeletal system development
GO:0002430 complement receptor mediated signaling pathway
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0010759 positive regulation of macrophage chemotaxis
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032695 negative regulation of interleukin-12 production
GO:0045600 positive regulation of fat cell differentiation
GO:0050848 regulation of calcium-mediated signaling
GO:0070098 chemokine-mediated signaling pathway
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ykd, PDBe:7ykd, PDBj:7ykd
PDBsum7ykd
PubMed36881626
UniProtQ99788|CML1_HUMAN Chemerin-like receptor 1 (Gene Name=CMKLR1)

[Back to BioLiP]