Structure of PDB 7yi2 Chain A Binding Site BS01

Receptor Information
>7yi2 Chain A (length=506) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSN
KELFTWFKNFVGYQEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVG
HPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETI
VNKIENSMTIYKKVIRKVYDKERGFEIIDALHETAPVVLKRLKQKDEEWR
RAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIK
VDQTNKKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLK
YFISLFFSISFEKIEESSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNE
RVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLIN
GDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIM
ALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQY
IALDDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yi2 Diverse modes of H3K36me3-guided nucleosomal deacetylation by Rpd3S.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		H1221 Q1222
Binding residue
(residue number reindexed from 1)		H405 Q406
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0016479 negative regulation of transcription by RNA polymerase I
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0034605 cellular response to heat
GO:0044804 nucleophagy
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0061186 negative regulation of silent mating-type cassette heterochromatin formation
GO:0061188 negative regulation of rDNA heterochromatin formation
GO:0070550 rDNA chromatin condensation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0032221 Rpd3S complex
GO:0033698 Rpd3L complex
GO:0070210 Rpd3L-Expanded complex
GO:0070822 Sin3-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yi2, PDBe:7yi2, PDBj:7yi2
PDBsum7yi2
PubMed37468628
UniProtP22579|SIN3_YEAST Transcriptional regulatory protein SIN3 (Gene Name=SIN3)

[Back to BioLiP]