Structure of PDB 7ygl Chain A Binding Site BS01

Receptor Information
>7ygl Chain A (length=178) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKLVATLGTAPGGVIESFLYLVKKGENIDEVRVVTTSNAEVKKAWRIVR
LMFVCCIQEKFPKVEISEHPLDIEDIYSEDDLRKVREFVEKQLGEGDYLD
ITGGRKSMSVAAALAAKNKGVKIITSIIPQDDYNKISKKVRELKEIPEIK
NRGECRQEMKETYCSLIVQDARSIEFEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ygl Molecular basis of stepwise cyclic tetra-adenylate cleavage by the type III CRISPR ring nuclease Crn1/Sso2081.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G9 A11 G13 E17 N39 D75 T102 G103 G104 R105 K106 I128 Q130 Y133 I136
Binding residue
(residue number reindexed from 1)		G9 A11 G13 E17 N39 D75 T102 G103 G104 R105 K106 I128 Q130 Y133 I136
Enzymatic activity
Enzyme Commision number 4.6.1.-
Gene Ontology
Biological Process
GO:0051607 defense response to virus
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ygl, PDBe:7ygl, PDBj:7ygl
PDBsum7ygl
PubMed36807980
UniProtQ7LYJ6|RN081_SACS2 CRISPR system ring nuclease SSO2081 (Gene Name=SSO2081)

[Back to BioLiP]