Structure of PDB 7yg3 Chain A Binding Site BS01

Receptor Information
>7yg3 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMAPRAP
WIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>7yg3 Chain B (length=9) Species: 12721 (Human immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RQDILDLWI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yg3 Functional and structural characteristics of HLA-B*13:01-mediated specific T cells reaction in dapsone-induced drug hypersensitivity.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
Y7 Y9 M45 R62 E63 I66 T73 N77 T80 Y84 R97 Y99 T143 K146 W147 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 M45 R62 E63 I66 T73 N77 T80 Y84 R97 Y99 T143 K146 W147 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links