Structure of PDB 7yf3 Chain A Binding Site BS01

Receptor Information

>7yf3 Chain A (length=264) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWAAIQAYHSAV
SSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGA
GDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYD
VISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGK
WEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYND
YYVLDDAVFVLKPV

Ligand information

>7yf3 Chain C (length=6) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HGHSHG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7yf3 Molecular basis for METTL9-mediated N1-histidine methylation
Resolution	3.434 Å
Binding residue (original residue number in PDB)	R123 G124 M126 N210 R214 Y295 C297 D300 Y306 L308
Binding residue (residue number reindexed from 1)	R69 G70 M72 N156 R160 Y241 C243 D246 Y252 L254

Enzymatic activity

Enzyme Commision number

2.1.1.-

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008168	methyltransferase activity
GO:0106370	protein-L-histidine N-pros-methyltransferase activity

	Biological Process
GO:0032259	methylation

	Cellular Component
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7yf3, PDBe:7yf3, PDBj:7yf3
PDBsum	7yf3
PubMed	37015930
UniProt	Q9H1A3\|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)

[Back to BioLiP]