Structure of PDB 7yey Chain A Binding Site BS01

Receptor Information
>7yey Chain A (length=162) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENTGAAEK
SITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLI
GKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAEEE
IMKKIRESYEND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yey Structure of MmIGF2BP3-KH12 in complex with 8-mer RNA
Resolution1.85 Å
Binding residue
(original residue number in PDB)		G208 A209 I211 G212 K213 E214 G215 I218 R219 K228 I229 V231 R233 K242
Binding residue
(residue number reindexed from 1)		G16 A17 I19 G20 K21 E22 G23 I26 R27 K36 I37 V39 R41 K50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7yey, PDBe:7yey, PDBj:7yey
PDBsum7yey
PubMed
UniProtQ9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 (Gene Name=Igf2bp3)

[Back to BioLiP]