Structure of PDB 7yew Chain A Binding Site BS01

Receptor Information

>7yew Chain A (length=160) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCPDEGW
ALKAIEALSGKMELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDS
LLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTL
KVAYIPDETA

Ligand information

>7yew Chain B (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acac

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7yew Structure of MmIGF2BP3 in complex with 7-mer RNA
Resolution	2.5 Å
Binding residue (original residue number in PDB)	Y5 L34 K36 Y39 F41 S73 V74 K76
Binding residue (residue number reindexed from 1)	Y6 L35 K37 Y40 F42 S74 V75 K77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7yew, PDBe:7yew, PDBj:7yew
PDBsum	7yew
PubMed
UniProt	Q9CPN8\|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 (Gene Name=Igf2bp3)

[Back to BioLiP]