Structure of PDB 7ydw Chain A Binding Site BS01

Receptor Information
>7ydw Chain A (length=92) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAVTLRVLLKDELLEPGEGVLSIYYLGRKFTGDLQLDGRIVWQETGQVFN
SPSAWATHCKKLVNPAKKSGWASVKYKGQKLDKYKAAWLRRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ydw Structures of MPND Reveal the Molecular Recognition of Nucleosomes.
Resolution2.47 Å
Binding residue
(original residue number in PDB)
S113 S115 W135
Binding residue
(residue number reindexed from 1)
S51 S53 W71
Enzymatic activity
Enzyme Commision number 3.4.-.-
External links
PDB RCSB:7ydw, PDBe:7ydw, PDBj:7ydw
PDBsum7ydw
PubMed36834777
UniProtQ3TV65|MPND_MOUSE MPN domain-containing protein (Gene Name=Mpnd)

[Back to BioLiP]