Structure of PDB 7yb7 Chain A Binding Site BS01

Receptor Information
>7yb7 Chain A (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNREIVMKYISYKLSQRGYEWESEVVHQTLRQAGDDFSLRYRRDFAEMSS
QLHLTPGTAYASFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
VLVDNIAAWMATYLNDHLHTWIQDNGGWDAFVELYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yb7 Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-XL by engaging a single-residue discrepancy
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y58 D61 F62 E86 L87 D90 N93 G95 R96 A99 L151 Y152
Binding residue
(residue number reindexed from 1)		Y41 D44 F45 E69 L70 D73 N76 G78 R79 A82 L134 Y135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7yb7, PDBe:7yb7, PDBj:7yb7
PDBsum7yb7
PubMed38368459
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2);
Q07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]